watching = false; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); Bei den Vodafone-Tarifen für junge Leute von 18-27 Jahren (und Eltern mit Kindern im Alter von 10-17 Jahren) gibt es nicht nur Features wie die GigaSwipe-Funktion, bei der ihr z. "eventActions" : [ "action" : "rerender" "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "defaultAriaLabel" : "", element.find('ul').slideUp(); { "event" : "editProductMessage", "actions" : [ { $(document).ready(function(){ ] "eventActions" : [ "}); watching = false; }, "accessibility" : false, "actions" : [ ] M-Pesa. "event" : "approveMessage", ] "actions" : [ "activecastFullscreen" : false, } var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "event" : "markAsSpamWithoutRedirect", window.location.replace('/t5/user/userloginpage'); "action" : "rerender" "selector" : "#kudosButtonV2", "componentId" : "kudos.widget.button", "actions" : [ { "action" : "rerender" "displaySubject" : "true", }); else { "message" : "1322022", "}); Lokað. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1321763 .lia-rating-control-passive', '#form_0'); if (element.hasClass('active')) { $('.lia-autocomplete-footer').append(ctaHTML); $('.community-menu').removeClass('active') ] "eventActions" : [ return; "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { Du bekommst eine Bestätigungs-Info. $('section.header-announcement').slideUp(); { if ( key == neededkeys[0] ) { "action" : "rerender" } $('#node-menu li.has-sub>a').on('click', function(){ "quiltName" : "ForumMessage", "event" : "ProductAnswerComment", // console.log(key); }, }; Vodafone Smart V10 4G. return; } }, "disallowZeroCount" : "false", { { var resetMenu = function() { ], 9 - 18. ] ;(function($){ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_12e0cba708b33b","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_12e0cba708b33b_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/20107&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Ge4n_J4jhBG2nujUrLvzaTaFhT2mzMINOfzSTXRhqMI. "event" : "MessagesWidgetEditCommentForm", { ], LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); ] "context" : "", "eventActions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1322022 .lia-rating-control-passive', '#form_1'); Vodafone bietet – wie auch andere Anbieter – eine Datenautomatik an, die das Datenvolumen eures Mobilfunkvertrags automatisch aufstockt,.. { ], "showCountOnly" : "false", "componentId" : "kudos.widget.button", { if (event.target.matches('.redirect')) { { { "actions" : [ 70997 ist freigeschaltet. Rádi vám o sobě řekneme více. } "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" "disallowZeroCount" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", 1. místo kategorii Telekomunikace. Vodafone má první zelenou síť 4 Kommentare zu 70997 ; Bewertung Anruftyp Kommentar Uhrzeit; Dummer Hurensohn : 26.11.2018 17:56 : Betrug : Abzocker! "action" : "rerender" "event" : "ProductAnswer", ] "eventActions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswerComment", "initiatorBinding" : true, Wir begrenzen Ihre Surfgeschwindigkeit auf 64 kbit/s. "actions" : [ // Oops. { "buttonDialogCloseAlt" : "Schließen", "event" : "removeThreadUserEmailSubscription", Bei den Vodafone RED Tarifen bedeutet das, dass nach dem … hidden hidden hidden hidden. "forceSearchRequestParameterForBlurbBuilder" : "false", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "actions" : [ Registered Office: Vodafone House. "kudosLinksDisabled" : "false", "actions" : [ lithadmin: [] "initiatorDataMatcher" : "data-lia-message-uid" "event" : "RevokeSolutionAction", "eventActions" : [ { It originated as part of Racal, a British radar and electronics firm founded in 1950. "message" : "1320080", watching = true; })(LITHIUM.jQuery); }, { "context" : "", "action" : "rerender" "action" : "rerender" }); "actions" : [ "context" : "lia-deleted-state", Zum Deal » Update Die Deals beim iPhone 12 wurden nochmals aufgebessert, schaut mal rein! "action" : "rerender" }, Fimmtudaga. { ] count++; }, { "context" : "", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_12e0cba708b33b_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/20107&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { { Vodafone: SpeedGo & Einmaloption. "event" : "MessagesWidgetMessageEdit", LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:quiltName,message", "context" : "", "actions" : [ "event" : "MessagesWidgetAnswerForm", "useCountToKudo" : "false", } "action" : "rerender" "action" : "rerender" }); "action" : "rerender" { ] "action" : "addClassName" ] "action" : "rerender" "context" : "", Bist du sicher, dass du fortfahren möchtest? "context" : "", { Smáralind. "actions" : [ "context" : "", "event" : "MessagesWidgetMessageEdit", var resetMenu = function() { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1320080,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? ] LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "event" : "MessagesWidgetEditAction", }, "}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "context" : "", "context" : "", ] { "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "", "action" : "rerender" "context" : "", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }, Vodafone se stal hlavním partnerem online konference New Technology, kterou pořádá deník E15. } "action" : "pulsate" { } "actions" : [ "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", }, }, } ] "action" : "pulsate" "action" : "rerender" ] ] ] { { "event" : "MessagesWidgetEditCommentForm", "initiatorDataMatcher" : "data-lia-kudos-id" { "initiatorDataMatcher" : "data-lia-message-uid" }); Vodafone UMTS Datenvolumen aufstocken per SMS - Forum UMTS/GPRS, WiMax, LTE und Satellit ... Buchung über 70997 mit 1 oder 5 klick _____ Gruß erbisdorf . var cookieDomain = 'forum.vodafone.de'; "actions" : [ LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); ] LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); "context" : "", "actions" : [ "context" : "", { Wie kann ich das wieder rückgängig machen??? "componentId" : "forums.widget.message-view", CookieManager = { "context" : "lia-deleted-state", "actions" : [ }, "actions" : [ } "displayStyle" : "horizontal", VODAFONE MOBILEINTERNET UPGRADE / DATEN-ZUSATZPAKET (NATIONAL) Normalerweise reicht Ihr gebuchtes mobiles Datenvolumen völlig aus: … { "event" : "deleteMessage", "action" : "rerender" { ;(function($){ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ] "action" : "rerender" //} else { "action" : "rerender" "context" : "", "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" "action" : "rerender" var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); } "event" : "MessagesWidgetEditAction", ] })(LITHIUM.jQuery); "actions" : [ "}); "event" : "addThreadUserEmailSubscription", }, { Execute whatever should happen when entering the right sequence { "actions" : [ LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); More than 100 channels with a huge selection to suit all the family. } "actions" : [ { "truncateBodyRetainsHtml" : "false", } "entity" : "1321763", "context" : "", Dezember 2020 in Handyvertrag im Vodafone-Netz Beste D2 Deals: Nintendo Switch für 4,99 € zur crash Allnet-Flat (7 GB, Vodafone ... Diesmal geht’s dann eben nicht um eine Drillisch Allnet-Flat mit 10 GB Datenvolumen, sondern um [weiterlesen] monatlich: ab 25. }, Dauerhaft - 1&1 … } "componentId" : "forums.widget.message-view", }); ], LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); return; } ] $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { }, { "eventActions" : [ { }, }, SpeedUp. $(event.data.selector).removeClass('cssmenu-open'); "action" : "rerender" Ich habe leider schneller auf etwas gedrückt als ich gelesen habe und kann die SMS jetzt nicht abschicken!!!! "kudosLinksDisabled" : "false", "event" : "deleteMessage", { $(document).ready(function() { return; { "context" : "envParam:quiltName,product,contextId,contextUrl", Automatische Nachbuchung (SpeedGo) Kosten: 250 MB für 3 Euro; Gültigkeit: bis Ende des Abrechnungszeitraums; Kosten für 100 MB: 1,20 Euro (=Durchschnitt) Prepaid-CallYa-Tarife mit mindestens 750 MB Datenvolumen. Read our policy, No thanks, I want to stay on Vodafone.com, M-mama: connecting pregnant women with emergency care in Africa, Vodafone named top 25 global corporate for working with start-ups, Tech companies can help create a sustainable future, How our F-LANE start-ups are supporting digital transformation in Africa, Vodafone recognised by CDP with ‘A’ score for climate change actions and transparency, Enabling customers to reduce their emissions. "truncateBody" : "true", } } if ( !watching ) { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":300,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXB18PBlRbAVQGBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVUDABXAVZQAhRXU1IASQEDAwZIV1EJU08EU1YMAlJUVVNXCVdAThUPVn1bVgB\/AhsIQCNFB11aQn8AXwhvXQYDUQtbVnlXDFgtWFAHDnIpVFpYEEkUDVpgBxFDMgdiQVcXT0QDEDEneyF2ZxRbARYga30vQloBRkBVVQBFRm56JzByREFcRFsGGA9dD11Cey14emASWhQbRA=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};